Cecropin A

Also known as: Cecropin, Antibacterial peptide A

An insect-derived antimicrobial peptide with strong activity against parasites and gram-negative bacteria.

Overview

Cecropin A is a 37-amino acid antimicrobial peptide first isolated from the cecropia moth (Hyalophora cecropia). It is one of the founding members of the cecropin family of antimicrobial peptides and shows potent activity against parasites, particularly those causing tropical diseases.

Mechanism of Action

Cecropin A contains two alpha-helical regions connected by a hinge. It binds to negatively charged membranes and creates ion channels through a 'carpet-like' mechanism at lower concentrations and membrane lysis at higher concentrations. This dual-phase action is particularly effective against parasitic membranes.

Pharmacokinetics

Rapid membrane association. More resistant to proteolysis than some other AMPs. Hybrid cecropin-melittin peptides show improved stability.

Dosing Protocols

Note: These are research protocols from literature. This is not medical advice.

1

Research Protocol

Dose

25-100 mcg

Frequency

1-2x daily

Duration

Variable

Experimental dosing based on target pathogen

Stacking Recommendations

Peptides that may be combined based on complementary mechanisms in research settings.

Rationale: Complementary mechanisms

Synergy: Different membrane disruption pathways enhance efficacy

Rationale: Immune support

Synergy: Direct killing plus enhanced immune clearance

Research Areas

MalariaTrypanosomiasisLeishmaniasisAntimicrobial DevelopmentVector Control

Key Research Findings

  • 1Kills Plasmodium berghei ookinetes in mosquito midgut (malaria transmission blocking)
  • 2Effective against Trypanosoma cruzi (Chagas disease) in vitro
  • 3Demonstrated leishmanicidal activity against multiple Leishmania species
  • 4Transgenic mosquitoes expressing cecropin show resistance to malaria parasites
  • 5Low cytotoxicity to mammalian cells at effective antiparasitic doses

Side Effects & Contraindications

Reported Side Effects

  • Injection site reactions
  • Rare allergic responses

Contraindications

  • Insect venom allergy (potential cross-reactivity)
  • Pregnancy (insufficient data)

Safety Considerations

Research compound. Derived from insect source. Generally non-toxic to mammalian cells at therapeutic concentrations.

Storage Requirements

Store lyophilized at -20°C. Reconstituted stable at 4°C for 48 hours.

Scientific References

Quick Reference

Sequence
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
Molecular Weight
4004.78 g/mol
Half-Life
30-60 minutes in serum
Bioavailability
Injectable; oral bioavailability limited
Research Stage
preclinical
Administration
Injection or topical